$0.00
Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
FREE Tether
  • FREE Tether
  • FREE Tether
  • FREE Tether
FREE Tether
$0.00 inc. tax
$0.00 ex. tax
? Tax based on California, United States.
Add a 48 inch tether for FREE. Please message us to make sure we add it to your order.
Product code 5N3iJKn
Product condition: New
Add to Cart

Customer Reviews

No Reviews Posted Yet - be the first!

write review

Featured Products

Cart Stay... Lifetime Warranty! Made in U.S.A. ,
Cart Stay... Lifetime Warranty! Made in U.S.A. ,
$9.99
Add To Cart
Cart Stay, 2 for $18, Lifetime Warranty.
Cart Stay, 2 for $18, Lifetime Warranty.
$18.00
Add To Cart
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i